PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G106700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 272aa    MW: 30403.9 Da    PI: 6.5151
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G106700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.7e-2191151257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+ F + n +ps++++++++++l    +++e++V++WFqNrRa+ k+
  Brast01G106700.1.p  91 RQRWTPTQMQLQILESIFDQgNGTPSKQKIKDITAELsqhgQISETNVYNWFQNRRARSKR 151
                         89*****************99**************************************97 PP

2Wus_type_Homeobox103.11.9e-3390153265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RWtPt+ Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
  Brast01G106700.1.p  90 ARQRWTPTQMQLQILESIFDQGNGTPSKQKIKDITAELSQHGQISETNVYNWFQNRRARSKRKQ 153
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-1785156IPR009057Homeodomain-like
PROSITE profilePS5007114.81987152IPR001356Homeobox domain
SMARTSM003895.3E-1489156IPR001356Homeobox domain
SuperFamilySSF466896.42E-1890154IPR009057Homeodomain-like
PfamPF000464.1E-1991151IPR001356Homeobox domain
CDDcd000862.35E-1391153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEWDKATAAT LAGEQVGERG GVEALGYVKV MTDEQMEVLR KQISIYATIC EQLVEMHRAL  60
TAHQDSIAGM RLGNLYCDPL MVHGGHKITA RQRWTPTQMQ LQILESIFDQ GNGTPSKQKI  120
KDITAELSQH GQISETNVYN WFQNRRARSK RKQAASLPNN AESEAEADEE SPTEKKPKSD  180
GPLHQNLATR AHNPERISEM HRHLDMEHEQ NRGMMYGSNS DNSSKSSGGL GQMSFYANVM  240
SNPRIDQFLG KVETPGSFSQ FRPGESFDMY G*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564486.11e-177PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-145WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLI1HSU61e-177I1HSU6_BRADI; Uncharacterized protein
STRINGBRADI2G53390.11e-177(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-63WUSCHEL related homeobox 13